Recombinant Dendroaspis angusticeps Dendrotoxin B, partial
Catalog Number:
CSB-YP882468DBG
- Images (0)
| Article Name: | Recombinant Dendroaspis angusticeps Dendrotoxin B, partial |
| Biozol Catalog Number: | CSB-YP882468DBG |
| Supplier Catalog Number: | CSB-YP882468DBG |
| Alternative Catalog Number: | CSB-YP882468DBG-1, CSB-YP882468DBG-100, CSB-YP882468DBG-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (DTX-B),CSB-PR2024 |
| Molecular Weight: | 4.9 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9PS09 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-30aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MICYSHKTPQPSATIGCEEKTCYKKSVRKL |
Product Guarantee and Expert Support
