Recombinant Bovine coronavirus Non-structural protein of 4.9 kDa (4a)
Catalog Number:
CSB-YP882514BJJ
- Images (0)
| Article Name: | Recombinant Bovine coronavirus Non-structural protein of 4.9 kDa (4a) |
| Biozol Catalog Number: | CSB-YP882514BJJ |
| Supplier Catalog Number: | CSB-YP882514BJJ |
| Alternative Catalog Number: | CSB-YP882514BJJ-1, CSB-YP882514BJJ-100, CSB-YP882514BJJ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (ns4.9)(4.9 kDa accessory protein),CSB-PR2024 |
| Molecular Weight: | 17.8 kDa |
| Tag: | C-terminal 6xHis-sumostar-tagged |
| UniProt: | Q9QAS1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-44aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MTTKFVFDLLAPDDILHPFNHVKLIIIRPIEVEHIIIATTMPAV |
Product Guarantee and Expert Support
