Recombinant Human Xylosyltransferase 2 (XYLT2), partial
Catalog Number:
CSB-YP884439HU
- Images (0)
| Article Name: | Recombinant Human Xylosyltransferase 2 (XYLT2), partial |
| Biozol Catalog Number: | CSB-YP884439HU |
| Supplier Catalog Number: | CSB-YP884439HU |
| Alternative Catalog Number: | CSB-YP884439HU-1, CSB-YP884439HU-100, CSB-YP884439HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Peptide O-xylosyltransferase 1)(Xylosyltransferase II)(XT-II)(XylT-II) |
| Molecular Weight: | 93.9 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9H1B5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 37-865aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GLEEDEAGEKGRQRKPRPLDPGEGSKDTDSSAGRRGSTGRRHGRWRGRAESPGVPVAKVVRAVTSRQRASRRVPPAPPPEAPGRQNLSGAAAGEALVGAAGFPPHGDTGSVEGAPQPTDNGFTPKCEIVGKDALSALARASTKQCQQEIANVVCLHQAGSLMPKAVPRHCQLTGKMSPGIQWDESQAQQPMDGPPVRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSDYLHREVVELAQGYDNVRVT |
Product Guarantee and Expert Support
