Recombinant Human Protein lin-28 homolog A (LIN28A)
Catalog Number:
CSB-YP884500HU(A4)E9
- Images (0)
| Article Name: | Recombinant Human Protein lin-28 homolog A (LIN28A) |
| Biozol Catalog Number: | CSB-YP884500HU(A4)E9 |
| Supplier Catalog Number: | CSB-YP884500HU(A4)e9 |
| Alternative Catalog Number: | CSB-YP884500HU(A4)E9-1, CSB-YP884500HU(A4)E9-100, CSB-YP884500HU(A4)E9-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Lin-28A)(Zinc finger CCHC domain-containing protein 1) |
| Molecular Weight: | 81.6 kDa |
| Tag: | N-terminal 6xHis-PDI-tagged |
| UniProt: | Q9H9Z2 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-209aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN |
Product Guarantee and Expert Support
