Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial
Catalog Number:
CSB-YP884515HU
- Images (0)
| Article Name: | Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial |
| Biozol Catalog Number: | CSB-YP884515HU |
| Supplier Catalog Number: | CSB-YP884515HU |
| Alternative Catalog Number: | CSB-YP884515HU-1, CSB-YP884515HU-100, CSB-YP884515HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Molecular Weight: | 62.2 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9HBX8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 25-567aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | APQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAVPGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFM |
Product Guarantee and Expert Support
