Recombinant Human Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D), partial
Catalog Number:
CSB-YP887006HU
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D), partial |
| Biozol Catalog Number: | CSB-YP887006HU |
| Supplier Catalog Number: | CSB-YP887006HU |
| Alternative Catalog Number: | CSB-YP887006HU-1, CSB-YP887006HU-100, CSB-YP887006HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Decoy receptor 2)(DcR2)(TNF-related apoptosis-inducing ligand receptor 4)(TRAIL receptor 4)(TRAIL-R4)(TRAIL receptor with a truncated death domain)(CD antigen CD264),CSB-PR2024 |
| Molecular Weight: | 18.3 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q9UBN6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 56-211aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH |
Product Guarantee and Expert Support
