Recombinant Human Actin-like protein 8 (ACTL8)
Catalog Number:
CSB-YP887982HU
- Images (0)
| Article Name: | Recombinant Human Actin-like protein 8 (ACTL8) |
| Biozol Catalog Number: | CSB-YP887982HU |
| Supplier Catalog Number: | CSB-YP887982HU |
| Alternative Catalog Number: | CSB-YP887982HU-1, CSB-YP887982HU-100, CSB-YP887982HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cancer/testis antigen 57 (CT57) |
| Molecular Weight: | 43.9 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q9H568 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-366aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRV |
Product Guarantee and Expert Support
