Recombinant Human Methionine synthase reductase (MTRR)

Catalog Number: CSB-YP890659HU
Article Name: Recombinant Human Methionine synthase reductase (MTRR)
Biozol Catalog Number: CSB-YP890659HU
Supplier Catalog Number: CSB-YP890659HU
Alternative Catalog Number: CSB-YP890659HU-1, CSB-YP890659HU-100, CSB-YP890659HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: MTRR, Methionine synthase reductase, MSR, EC 1.16.1.8
Molecular Weight: 82.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9UBK8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-725aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESS