Recombinant Human Protein-arginine deiminase type-3 (PADI3)

Catalog Number: CSB-YP891552HU
Article Name: Recombinant Human Protein-arginine deiminase type-3 (PADI3)
Biozol Catalog Number: CSB-YP891552HU
Supplier Catalog Number: CSB-YP891552HU
Alternative Catalog Number: CSB-YP891552HU-1, CSB-YP891552HU-100, CSB-YP891552HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Peptidylarginine deiminase III Protein-arginine deiminase type III
Molecular Weight: 76.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9ULW8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-664aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYISPNMERGRERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDISLDCDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCDVQDNCDQHVHCLQDLEDMSVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHICGPEDVCEAYRHVLGQDKVSYEVPRLHGDEERFFVEGL