Recombinant Human F-box/LRR-repeat protein 2 (FBXL2)
Catalog Number:
CSB-YP892134HU
- Images (0)
| Article Name: | Recombinant Human F-box/LRR-repeat protein 2 (FBXL2) |
| Biozol Catalog Number: | CSB-YP892134HU |
| Supplier Catalog Number: | CSB-YP892134HU |
| Alternative Catalog Number: | CSB-YP892134HU-1, CSB-YP892134HU-100, CSB-YP892134HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | F-box and leucine-rich repeat protein 2 F-box protein FBL2/FBL3 |
| Molecular Weight: | 49.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9UKC9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-423aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTA |
Product Guarantee and Expert Support
