Recombinant Human Growth/differentiation factor 2 (GDF2), partial
Catalog Number:
CSB-YP892325HU1
- Images (0)
| Article Name: | Recombinant Human Growth/differentiation factor 2 (GDF2), partial |
| Biozol Catalog Number: | CSB-YP892325HU1 |
| Supplier Catalog Number: | CSB-YP892325HU1 |
| Alternative Catalog Number: | CSB-YP892325HU1-1, CSB-YP892325HU1-100, CSB-YP892325HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Bone morphogenetic protein 9 Short name: BMP-9 |
| Molecular Weight: | 16.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9UK05 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 300-429aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR |
Product Guarantee and Expert Support
