Recombinant Human Talin-2 (TLN2), partial Preis auf Anfrage
Catalog Number:
CSB-YP897282HU
- Images (0)
| Article Name: | Recombinant Human Talin-2 (TLN2), partial Preis auf Anfrage |
| Biozol Catalog Number: | CSB-YP897282HU |
| Supplier Catalog Number: | CSB-YP897282HU |
| Alternative Catalog Number: | CSB-YP897282HU-1,CSB-YP897282HU-100,CSB-YP897282HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | DKFZp451B1011, DKFZp686I0976, DKFZp686K0979, ILWEQ, KIAA0320, Talin-2, talin2, TLN 2, TLN2, TLN2_HUMAN |
| Molecular Weight: | 39.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9Y4G6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 88-406aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVM |
Product Guarantee and Expert Support
