Recombinant Human IL-32 alpha protein(N-His)(active)
Catalog Number:
ELA-PKSH034116
- Images (0)
| Article Name: | Recombinant Human IL-32 alpha protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSH034116 |
| Supplier Catalog Number: | PKSH034116 |
| Alternative Catalog Number: | ELA-PKSH034116-100, ELA-PKSH034116-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Human |
| Alternative Names: | IL-32alpha,IL-32beta,IL-32delta,IL-32gamma,NK4,TAIF,TAIFa,TAIFb,TAIFc,TAIFd |
| Tag: | N-His |
| NCBI: | 24001 |
| UniProt: | P24001 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK |
| Target: | IL-32 alpha |
Product Guarantee and Expert Support
