Recombinant Human AITRL protein(N-His)(active)
Catalog Number:
ELA-PKSH034121
- Images (0)
| Article Name: | Recombinant Human AITRL protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSH034121 |
| Supplier Catalog Number: | PKSH034121 |
| Alternative Catalog Number: | ELA-PKSH034121-100, ELA-PKSH034121-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Human |
| Alternative Names: | TL6,GITRL,TNLG2A,hGITRL,TNFSF18 |
| Tag: | N-His |
| NCBI: | 9 |
| UniProt: | Q9UNG2 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
| Target: | AITRL |
Product Guarantee and Expert Support
