Recombinant Human BMP-4 protein(N-His)(active)
Catalog Number:
ELA-PKSH034130
- Images (0)
| Article Name: | Recombinant Human BMP-4 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSH034130 |
| Supplier Catalog Number: | PKSH034130 |
| Alternative Catalog Number: | ELA-PKSH034130-100, ELA-PKSH034130-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Human |
| Alternative Names: | BMP-2B,DVR4 |
| Tag: | N-His |
| NCBI: | 12644 |
| UniProt: | P12644 |
| Expression System: | E.coli |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from a solution containing 20 mM sodium carbonate,pH 9.0.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRI |
| Target: | BMP-4 |
Product Guarantee and Expert Support
