Recombinant Human FGF-12 protein(N-His)(active)

Catalog Number: ELA-PKSH034155
Article Name: Recombinant Human FGF-12 protein(N-His)(active)
Biozol Catalog Number: ELA-PKSH034155
Supplier Catalog Number: PKSH034155
Alternative Catalog Number: ELA-PKSH034155-100, ELA-PKSH034155-20
Manufacturer: Elabscience
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: EIEE47B,FHF1
Tag: N-His
NCBI: 61328
UniProt: P61328
Expression System: E.coli
Purity: > 98 % as determined by reducing SDS-PAGE.
Form: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequence: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Target: FGF-12