Recombinant Human CXCL12 (24-88) protein(N-His)(active)
Catalog Number:
ELA-PKSH034169
- Images (0)
| Article Name: | Recombinant Human CXCL12 (24-88) protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSH034169 |
| Supplier Catalog Number: | PKSH034169 |
| Alternative Catalog Number: | ELA-PKSH034169-100, ELA-PKSH034169-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Human |
| Alternative Names: | IRH,PBSF,SCYB12,SDF1,TLSF,TPAR1 |
| Tag: | N-His |
| NCBI: | 48061 |
| UniProt: | P48061 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from a solution containing 20 mM sodium citrate, 0.1 MNaCl, pH 4.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Target: | CXCL12 |
Product Guarantee and Expert Support
