Recombinant Human PGA5 protein(N-His)
Catalog Number:
ELA-PKSH034174
- Images (0)
| Article Name: | Recombinant Human PGA5 protein(N-His) |
| Biozol Catalog Number: | ELA-PKSH034174 |
| Supplier Catalog Number: | PKSH034174 |
| Alternative Catalog Number: | ELA-PKSH034174-100, ELA-PKSH034174-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Pg5 |
| Tag: | N-His |
| NCBI: | 0 |
| UniProt: | P0DJD9 |
| Expression System: | E.coli |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQI |
| Target: | PGA5 |
Product Guarantee and Expert Support
