Recombinant Human Galectin-4 protein(N-His)(active)

Catalog Number: ELA-PKSH034184
Article Name: Recombinant Human Galectin-4 protein(N-His)(active)
Biozol Catalog Number: ELA-PKSH034184
Supplier Catalog Number: PKSH034184
Alternative Catalog Number: ELA-PKSH034184-100, ELA-PKSH034184-20
Manufacturer: Elabscience
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: LGALS4,GAL4,L36LBP
Tag: N-His
NCBI: 56470
UniProt: P56470
Expression System: E.coli
Purity: > 98 % as determined by reducing SDS-PAGE.
Form: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequence: MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNG
Target: Galectin-4