Recombinant Human CXCL13 protein(N-His)(active)
Catalog Number:
ELA-PKSH034197
- Images (0)
| Article Name: | Recombinant Human CXCL13 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSH034197 |
| Supplier Catalog Number: | PKSH034197 |
| Alternative Catalog Number: | ELA-PKSH034197-100, ELA-PKSH034197-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Human |
| Alternative Names: | B-cell Attracting Chemokine-1,BLR1 Ligand,BCA-1/BLC |
| Tag: | N-His |
| NCBI: | 43927 |
| UniProt: | O43927 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP |
| Target: | CXCL13 |
Product Guarantee and Expert Support
