Recombinant Human Noggin protein(C-His)(active)
Catalog Number:
ELA-PKSH034199
- Images (0)
| Article Name: | Recombinant Human Noggin protein(C-His)(active) |
| Biozol Catalog Number: | ELA-PKSH034199 |
| Supplier Catalog Number: | PKSH034199 |
| Alternative Catalog Number: | ELA-PKSH034199-100, ELA-PKSH034199-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Human |
| Alternative Names: | NOG,Noggin,SYM1,symphalangism 1 (proximal),synostoses (multiple) syndrome 1,SYNS1,SYNS1A |
| Tag: | C-His |
| NCBI: | 13253 |
| UniProt: | Q13253 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH8.0.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Target: | Noggin |
Product Guarantee and Expert Support
