Recombinant Mouse CXCL1 protein(N-His)(active)
Catalog Number:
ELA-PKSM041463
- Images (0)
| Article Name: | Recombinant Mouse CXCL1 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSM041463 |
| Supplier Catalog Number: | PKSM041463 |
| Alternative Catalog Number: | ELA-PKSM041463-100, ELA-PKSM041463-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Mouse |
| Alternative Names: | Growth-Regulated Alpha Protein,C-X-C Motif Chemokine 1,GRO-Alpha(1-73),Melanoma Growth Stimulatory Activity,MGSA,Neutrophil-Activating Protein 3,NAP-3,CXCL1,GRO,GRO1,GROA,MGSA,SCYB1 |
| Tag: | N-His |
| NCBI: | 12850 |
| UniProt: | P12850 |
| Expression System: | E.coli |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK |
| Target: | CXCL1 |
Product Guarantee and Expert Support
