Recombinant Mouse IL-20 protein(N-His)(active)
Catalog Number:
ELA-PKSM041468
- Images (0)
| Article Name: | Recombinant Mouse IL-20 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSM041468 |
| Supplier Catalog Number: | PKSM041468 |
| Alternative Catalog Number: | ELA-PKSM041468-100, ELA-PKSM041468-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Mouse |
| Alternative Names: | Interleukin-20,IL-20,Cytokine Zcyto10,IL20,ZCYTO10 |
| Tag: | N-His |
| NCBI: | 9 |
| UniProt: | Q9JKV9 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MKGFGLAFGLFSAVGFLLWTPLTGLKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML |
| Target: | IL-20 |
Product Guarantee and Expert Support
