Recombinant Mouse IL-24 protein(N-His)(active)
Catalog Number:
ELA-PKSM041470
- Images (0)
| Article Name: | Recombinant Mouse IL-24 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSM041470 |
| Supplier Catalog Number: | PKSM041470 |
| Alternative Catalog Number: | ELA-PKSM041470-100, ELA-PKSM041470-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Mouse |
| Alternative Names: | MCGF (Mast Cell Growth Factor),Multi-CSF,HCGF,P-cell stimulation factor,Interleukin-3b |
| Tag: | N-His |
| NCBI: | 925 |
| UniProt: | Q925S4 |
| Expression System: | E.coli |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MSWGLQILPCLSLILLLWNQVPGLEGQEFRSGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL |
| Target: | IL-24 |
Product Guarantee and Expert Support
