Recombinant Mouse BAFF protein(N-His)(active)

Catalog Number: ELA-PKSM041485
Article Name: Recombinant Mouse BAFF protein(N-His)(active)
Biozol Catalog Number: ELA-PKSM041485
Supplier Catalog Number: PKSM041485
Alternative Catalog Number: ELA-PKSM041485-100, ELA-PKSM041485-20
Manufacturer: Elabscience
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: p40 cytokine,T-cell growth factor p40
Tag: N-His
NCBI: 9
UniProt: Q9WU72
Expression System: E.coli
Purity: > 98 % as determined by reducing SDS-PAGE.
Form: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequence: MDESAKTLPPPCLCFCSEKGEDMKVGYDPITPQKEEGAWFGICRDGRLLAATLLLALLSSSFTAMSLYQLAALQADLMNLRMELQSYRGSATPAAAGAPELTAGVKLLTPAAPRPHNSSRGHRNRRAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLF
Target: BAFF