Recombinant Mouse IFN alpha 1a protein(N-His)(active)

Catalog Number: ELA-PKSM041492
Article Name: Recombinant Mouse IFN alpha 1a protein(N-His)(active)
Biozol Catalog Number: ELA-PKSM041492
Supplier Catalog Number: PKSM041492
Alternative Catalog Number: ELA-PKSM041492-100, ELA-PKSM041492-20
Manufacturer: Elabscience
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: FIL1 delta,IL-1F5,IL-1HY1,IL-1L1,IL-1RP3,IL-1ra Homolog 1,IL-1 delta
Tag: N-His
NCBI: 01572
UniProt: P01572
Expression System: E.coli
Purity: > 98 % as determined by reducing SDS-PAGE.
Form: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequence: MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG FPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQ GCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN VLGRLREEK
Target: IFN alpha 1a