Recombinant Mouse VEGF121 protein(N-His)(active)
Catalog Number:
ELA-PKSM041502
- Images (0)
| Article Name: | Recombinant Mouse VEGF121 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSM041502 |
| Supplier Catalog Number: | PKSM041502 |
| Alternative Catalog Number: | ELA-PKSM041502-100, ELA-PKSM041502-20 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Mouse |
| Alternative Names: | Leukocyte Interferon,IFNA2,B cell Interferon,Type I Interferon |
| Tag: | N-His |
| NCBI: | 00731 |
| UniProt: | Q00731 |
| Expression System: | E.coli |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Target: | VEGF121 |
Product Guarantee and Expert Support
