Recombinant Swine IL-4 protein(N-His)(active)
Catalog Number:
ELA-PKSS000004
- Images (0)
| Article Name: | Recombinant Swine IL-4 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSS000004 |
| Supplier Catalog Number: | PKSS000004 |
| Alternative Catalog Number: | ELA-PKSS000004-20, ELA-PKSS000004-5 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Porcine |
| Alternative Names: | BCGF,BCDF,B-cell Stimulating Factor (BSF-1) |
| Tag: | N-His |
| NCBI: | 04745 |
| UniProt: | Q04745 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC |
| Target: | IL-4 |
Product Guarantee and Expert Support
