Recombinant Swine IL-8 protein(N-His)(active)
Catalog Number:
ELA-PKSS000006
- Images (0)
| Article Name: | Recombinant Swine IL-8 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSS000006 |
| Supplier Catalog Number: | PKSS000006 |
| Alternative Catalog Number: | ELA-PKSS000006-20, ELA-PKSS000006-5 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Porcine |
| Alternative Names: | Monocyte-Derived Neutrophil Chemotactic Factor (MDNCF),Neutrophil Activating Factor (NAF),AMCF-I,CXCL8 |
| Tag: | C-His |
| NCBI: | 26894 |
| UniProt: | P26894 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MTSKLAVAFLAVFLLSAALCEAAVLARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ |
| Target: | IL-8 |
Product Guarantee and Expert Support
