Recombinant Swine BMP-4 protein(N-His)
Catalog Number:
ELA-PKSS000011
- Images (0)
| Article Name: | Recombinant Swine BMP-4 protein(N-His) |
| Biozol Catalog Number: | ELA-PKSS000011 |
| Supplier Catalog Number: | PKSS000011 |
| Alternative Catalog Number: | ELA-PKSS000011-20, ELA-PKSS000011-5 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Species Reactivity: | Porcine |
| Alternative Names: | Bone morphogenetic protein 4,Bone morphotic protein 4,BMP4 |
| Tag: | N-His |
| NCBI: | 7 |
| UniProt: | A7LJT9 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQTHSVGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPPEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVR |
| Target: | BMP-4 |
Product Guarantee and Expert Support
