Recombinant Swine FGF-2 protein(N-His)(active)
Catalog Number:
ELA-PKSS000016
- Images (0)
| Article Name: | Recombinant Swine FGF-2 protein(N-His)(active) |
| Biozol Catalog Number: | ELA-PKSS000016 |
| Supplier Catalog Number: | PKSS000016 |
| Alternative Catalog Number: | ELA-PKSS000016-20, ELA-PKSS000016-5 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Application: | Cell Culture |
| Species Reactivity: | Porcine |
| Alternative Names: | Fgfb,bFGF,FGF-basic |
| Tag: | N-His |
| NCBI: | 03969 |
| UniProt: | P03969 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from a solution containing 0.01% sarkosyl in 1X PBS, pH 7.4.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
| Target: | FGF-2 |
Product Guarantee and Expert Support
