Recombinant Swine CXCL13 protein(N-His)
Catalog Number:
ELA-PKSS000023
- Images (0)
| Article Name: | Recombinant Swine CXCL13 protein(N-His) |
| Biozol Catalog Number: | ELA-PKSS000023 |
| Supplier Catalog Number: | PKSS000023 |
| Alternative Catalog Number: | ELA-PKSS000023-20, ELA-PKSS000023-5 |
| Manufacturer: | Elabscience |
| Category: | Proteine/Peptide |
| Species Reactivity: | Porcine |
| Alternative Names: | C-X-C motif chemokine 13,Angie,B cell-attracting chemokine 1,B lymphocyte chemoattractant,CXC chemokine BLC,Small-inducible cytokine B13,BCA1,BLC,SCYB13 |
| Tag: | N-His |
| NCBI: | 0 |
| UniProt: | A0A287A706 |
| Expression System: | E.coli |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Form: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequence: | MRFTLGSLLLVLLLACSLFPIHGVLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA |
| Target: | CXCL13 |
Product Guarantee and Expert Support
