Toll-like receptor 4 polyclonal antibody

Catalog Number: ENZ-ALX-210-638-C200
Article Name: Toll-like receptor 4 polyclonal antibody
Biozol Catalog Number: ENZ-ALX-210-638-C200
Supplier Catalog Number: ALX-210-638-C200
Alternative Catalog Number: ENZ-ALX-210-638-C200-200
Manufacturer: Enzo Life Sciences
Host: Goat
Category: Antikörper
Application: IHC, ICC, WB
Species Reactivity: Mouse, Human
Immunogen: Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4).
Alternative Names: CD284, TLR4
Toll-like receptor 4 polyclonal antibody
Clonality: Polyclonal
UniProt: O00206
Purity: Epitope-affinity purified IgG.
Form: Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
Target: TLR| TLR4