TRAIL-R3 (human) polyclonal antibody
Catalog Number:
ENZ-ALX-210-744-C200
| Article Name: |
TRAIL-R3 (human) polyclonal antibody |
| Biozol Catalog Number: |
ENZ-ALX-210-744-C200 |
| Supplier Catalog Number: |
ALX-210-744-C200 |
| Alternative Catalog Number: |
ENZ-ALX-210-744-C200-200 |
| Manufacturer: |
Enzo Life Sciences |
| Host: |
Goat |
| Category: |
Antikörper |
| Application: |
IHC, ICC, FC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3. |
| Alternative Names: |
TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C |
| TRAIL-R3 (human) polyclonal antibody |
| Clonality: |
Polyclonal |
| UniProt: |
O14798 |
| Purity: |
Epitope-affinity purified IgG. |
| Form: |
Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide. |
| Target: |
TRAIL receptor |
| Application Notes: |
Detects a band of ~33kDa by Western blot. |
