TRAIL-R3 (human) polyclonal antibody
Catalog Number:
ENZ-ALX-210-744-C200
Article Name: |
TRAIL-R3 (human) polyclonal antibody |
Biozol Catalog Number: |
ENZ-ALX-210-744-C200 |
Supplier Catalog Number: |
ALX-210-744-C200 |
Alternative Catalog Number: |
ENZ-ALX-210-744-C200-200 |
Manufacturer: |
Enzo Life Sciences |
Host: |
Goat |
Category: |
Antikörper |
Application: |
IHC, ICC, FC, WB |
Species Reactivity: |
Human |
Immunogen: |
Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3. |
Alternative Names: |
TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C |
TRAIL-R3 (human) polyclonal antibody |
Clonality: |
Polyclonal |
UniProt: |
O14798 |
Purity: |
Epitope-affinity purified IgG. |
Form: |
Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide. |
Target: |
TRAIL receptor |
Application Notes: |
Detects a band of ~33kDa by Western blot. |