Toll-like receptor 5 (human) polyclonal antibody

Catalog Number: ENZ-ALX-210-853-C200
Article Name: Toll-like receptor 5 (human) polyclonal antibody
Biozol Catalog Number: ENZ-ALX-210-853-C200
Supplier Catalog Number: ALX-210-853-C200
Alternative Catalog Number: ENZ-ALX-210-853-C200-200
Manufacturer: Enzo Life Sciences
Host: Goat
Category: Antikörper
Application: IHC, ICC, FC, WB
Species Reactivity: Human
Immunogen: Synthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
Alternative Names: TLR5, Toll/Interleukin-1 receptor-like gene 3, TIL3
Toll-like receptor 5 (human) polyclonal antibody
Clonality: Polyclonal
UniProt: O60602
Purity: Epitope-affinity purified IgG.
Form: Affinity purified antibody in 10 mM KHPO4, 140 mM NaCl, BSA 1mg/ml and 0.1% sodium azide.
Target: TLR| TLR5