E2F1 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
FBX-E2F1-101AP
Article Name: |
E2F1 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
FBX-E2F1-101AP |
Supplier Catalog Number: |
E2F1-101AP |
Alternative Catalog Number: |
FBX-E2F1-101AP-100 |
Manufacturer: |
FabGennix |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ELISA, WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
Conjugation: |
Unconjugated |
Alternative Names: |
E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, retinoblastoma-associated protein 1, retinoblastoma-binding protein 3, transcription factor E2F1 |
Clonality: |
Polyclonal |
Isotype: |
IgG |
NCBI: |
1869 |
UniProt: |
Q01094 |
Purity: |
Affinity Purified |
Target: |
E2F1 |