E2F1 Antibody BIOTIN, Biotin, Rabbit, Polyclonal

Catalog Number: FBX-E2F1N-BIOTIN
Article Name: E2F1 Antibody BIOTIN, Biotin, Rabbit, Polyclonal
Biozol Catalog Number: FBX-E2F1N-BIOTIN
Supplier Catalog Number: E2F1n-BIOTIN
Alternative Catalog Number: FBX-E2F1N-BIOTIN-100
Manufacturer: FabGennix
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Conjugation: Biotin
Alternative Names: E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, retinoblastoma-associated protein 1, retinoblastoma-binding protein 3, transcription factor E2F1
E2F1 Antibody BIOTIN
Clonality: Polyclonal
Isotype: IgG
NCBI: 1869
UniProt: Q01094
Purity: Affinity Purified
Target: E2F1