Rab11A antibody [4H9], IgG2b, Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Rab11A antibody [4H9], IgG2b, Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: GTX03669
• Supplier Catalog Number: GTX03669
• Alternative Catalog Number: GTX03669-100
• Manufacturer: GeneTex
• Host: Mouse
• Category: Antikörper
• Application: FACS, ICC, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
• Conjugation: Unconjugated
• Alternative Names: RAB11A, member RAS oncogene family , YL8

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Clone Designation: [4H9]
• Molecular Weight: 24
• Isotype: IgG2b
• NCBI: 8766
• UniProt: P62491
• Buffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, no preservative.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.25-0.5 µg/ml. ICC/IF: 5 µg/ml. IHC-P: 2-5 µg/ml. FACS: 1-3 µg/1x106cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.