MMP8 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: MMP8 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX03673
• Supplier Catalog Number: GTX03673
• Alternative Catalog Number: GTX03673-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 53
• NCBI: 17394
• UniProt: O70138
• Buffer: 0.9 mg NaCl, 0.2 mg Na2HPO4, 5mg BSA, 0.05mg sodium azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/m. ELISA: 0.1-0.5µg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.