AHR antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: AHR antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: GTX03719
• Supplier Catalog Number: GTX03719
• Alternative Catalog Number: GTX03719-100
• Manufacturer: GeneTex
• Host: Rabbit
• Category: Antikörper
• Application: FACS, ICC, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).
• Conjugation: Unconjugated
• Alternative Names: aryl hydrocarbon receptor , bHLHe76

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
• Molecular Weight: 96
• NCBI: 196
• UniProt: P35869
• Buffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg sodium azide.
• Form: Liquid

Application Notes

• Application Notes: WB: 0.1-0.5µg/ml. ICC/IF: 0.5-1µg/ml. IHC-P: 0.5-1µg/ml. FACS: 1-3µg/1x106 cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.