NTCP antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
GTX17693
- Images (9)
| Article Name: | NTCP antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | GTX17693 |
| Supplier Catalog Number: | GTX17693 |
| Alternative Catalog Number: | GTX17693-100 |
| Manufacturer: | GeneTex |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | FACS, IHC-Fr, IHC-P, WB |
| Species Reactivity: | Mouse, Rat |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino |
| Conjugation: | Unconjugated |
| Alternative Names: | solute carrier family 10 (sodium/bile acid cotransporter family), member 1 , Ntcp |
| NTCP antibody, IgG, Unconjugated, Rabbit, Polyclonal |
| Clonality: | Polyclonal |
| Concentration: | 500 µg/ml (Please refer to the vial label for the specific concentration.) |
| Clone Designation: | Polyclonal |
| Molecular Weight: | 39 |
| Isotype: | IgG |
| NCBI: | 20493 |
| UniProt: | O08705 |
| Buffer: | 2.5% BSA, 0.45% NaCl, 0.1% Na2HPO4, 0.025% Sodium azide. |
| Source: | Mouse |
| Purity: | Purified by antigen-affinity chromatography |
| Form: | Liquid |
| Application Notes: | WB: 0.1-0.5µg/ml. IHC-P: 0.5-1µg/ml. IHC-Fr: 0.5-1µg/ml. FACS: 1-3µg/1x106cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
|
|
GTX17693 WB Image |
|
|
WB analysis of various samples using GTX17693 NTCP antibody. Lane 1 : rat liver tissue lysates (positive control) Lane 2 : rat kidney tissue lysates, (negative control) Dilution : 0.25 μg/mL Loading : 50μg of sample under reducing conditions |
|
|
IHC-P analysis of rat liver tissue using GTX17693 NTCP antibody. Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins Dilution : 1μg/ml |
|
|
IHC-Fr analysis of mouse liver tissue using GTX17693 NTCP antibody. Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins Dilution : 1μg/ml |
|
|
IHC-P analysis of mouse liver tissue using GTX17693 NTCP antibody. Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins Dilution : 1μg/ml |
|
|
IHC-P analysis of mouse liver tissue using GTX17693 NTCP antibody. Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins Dilution : 1μg/ml |
|
|
IHC-P analysis of mouse liver tissue using GTX17693 NTCP antibody. Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins Dilution : 1μg/ml |
|
|
FACS analysis of BRL cells using GTX17693 NTCP antibody. Blue : Primary antibody Green : Isotype control Red : Cell only control Antibody amount : 1μg/1x10⁶ cells for 30 min at 20ºC |
|
|
IHC-P analysis of human liver cancer tissue using GTX17693 NTCP antibody. Antigen retireval : Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins Dilution : 1μg/ml |
Product Guarantee and Expert Support
