LL 37 (human), CAS [[154947-66-7]]

Product Overview

• Article Name: LL 37 (human), CAS [[154947-66-7]]
• Biozol Catalog Number: ISC-AM-001
• Supplier Catalog Number: AM-001
• Alternative Catalog Number: ISC-AM-001
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Ropocamptide, hCAP 18, Cathelicidin, LL 37, LL-37, cathelicidin, LL 37 (human)

Product Description

LL 37 (human) is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), which has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functi

Product Properties

• Molecular Weight: 4493.3
• NCBI: 2013
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: [LL-37, 37 aa]
• CAS Number: [154947-66-7]
• Formula: C205H340N60O53
• Target: Antibacterials,Antivirals

Application Notes

• Application Notes: ProductType: Antimicrobial peptides