LL 37 (human) scrambled

Catalog Number: ISC-AM-002
Article Name: LL 37 (human) scrambled
Biozol Catalog Number: ISC-AM-002
Supplier Catalog Number: AM-002
Alternative Catalog Number: ISC-AM-002
Manufacturer: Isca Biochemicals
Category: Biochemikalien
LL 37, a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxi
Molecular Weight: 4493.3
NCBI: 2013
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Formula: C205H340N60O53
Target: Antibacterials
Application Notes: ProductType: Peptides