LL 37 (human), 5-FAM

Product Overview

• Article Name: LL 37 (human), 5-FAM
• Biozol Catalog Number: ISC-AM-004
• Supplier Catalog Number: AM-004
• Alternative Catalog Number: ISC-AM-004
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

LL 37 (human), 5-FAM is the N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37. The carboxyfluorescein group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the carboxyfluorescein tag allows fl

Product Properties

• Molecular Weight: 4963.6
• NCBI: 2013
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: 5FAM-Ahx[LL-37, 37 aa]
• Formula: C226H351N61O58
• Target: Antibacterials

Application Notes

• Application Notes: ProductType: Fluorescent labelled peptides