mCRAMP (mouse)

Catalog Number: ISC-AM-040
Article Name: mCRAMP (mouse)
Biozol Catalog Number: ISC-AM-040
Supplier Catalog Number: AM-040
Alternative Catalog Number: ISC-AM-040
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Mouse calethicidin related antimicrobial peptide
mCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibit
Molecular Weight: 3878.7
NCBI: 2015
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Formula: C178H302N50O46
Target: Antibacterials,Antivirals
Application Notes: ProductType: Antimicrobial peptides