Cecropin A, CAS [[80451-04-3]]

Product Overview

• Article Name: Cecropin A, CAS [[80451-04-3]]
• Biozol Catalog Number: ISC-AM-080
• Supplier Catalog Number: AM-080
• Alternative Catalog Number: ISC-AM-080
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: CeA

Product Description

Cecropin A (CeA) is a natural linear cationic alpha-helical antimicrobial peptide (AMP) originally identified in moths (Hyalophora cecropia) and later in pig intestine. Cecropin A contains a strongly cationic region at its N-terminus and a large hydrophobic

Product Properties

• Molecular Weight: 4003.8
• NCBI: 2007
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
• CAS Number: [80451-04-3]
• Formula: C184H313N53O46
• Target: Antibacterials,Antifungals

Application Notes

• Application Notes: ProductType: Antimicrobial peptides