Cecropin B, CAS [[80451-05-4]]

Catalog Number: ISC-AM-081
Article Name: Cecropin B, CAS [[80451-05-4]]
Biozol Catalog Number: ISC-AM-081
Supplier Catalog Number: AM-081
Alternative Catalog Number: ISC-AM-081
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Cecropin B is a natural linear cationic alpha-helical antimicrobial peptide (AMP) originally identified in insects. Cecropin B has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens,
Molecular Weight: 3834.7
NCBI: 2007
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
CAS Number: [80451-05-4]
Formula: C176H302N52O41S
Target: Antibacterials,Antifungals
Application Notes: ProductType: Antimicrobial peptides