RsAFP2

Catalog Number: ISC-AM-140
Article Name: RsAFP2
Biozol Catalog Number: ISC-AM-140
Supplier Catalog Number: AM-140
Alternative Catalog Number: ISC-AM-140
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Raphanus sativus antifungal peptide 2
RsAFP2, or raphanus sativus antifungal peptide 2, is an an antifungal plant defensin isolated from seeds of the radish, raphanus sativus, which interacts with glucosylceramides (GlcCer) in the membranes of susceptible yeast and fungi to induce membrane p
Molecular Weight: 5710.6
NCBI: 2007
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: PyroGlu-KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
Formula: C244H368N76O68S8
Target: Antifungals,Plant science
Application Notes: ProductType: Antimicrobial peptides