Cys-LL37

Product Overview

• Article Name: Cys-LL37
• Biozol Catalog Number: ISC-AM-180
• Supplier Catalog Number: AM-180
• Alternative Catalog Number: ISC-AM-180
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

Cys-LL 37 is the host defence peptide LL 37 with an additional N-terminal cysteine attached. This allows immobilization of LL 37 as a novel approach towards endowing material surfaces with bactericidal properties.

Product Properties

• Molecular Weight: 4596.5
• NCBI: 2006
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
• Formula: C208H345N61O54S1
• Target: Antibacterials

Application Notes

• Application Notes: ProductType: Peptides