LL 37 (human) biotinylated, pegylated

Product Overview

• Article Name: LL 37 (human) biotinylated, pegylated
• Biozol Catalog Number: ISC-AM-200
• Supplier Catalog Number: AM-200
• Alternative Catalog Number: ISC-AM-200
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated version of the host defence peptide LL 37 with a biotin group attached via a pegylated chain, PEG(4). The presence of the biotin tag allows numerous biochemical and microbiological ap

Product Properties

• Molecular Weight: 4967
• NCBI: 2013
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: Biotin-[PEG(4)][LL-37, 37 aa]
• Formula: C226H376N64O59S
• Target: Antibacterials

Application Notes

• Application Notes: ProductType: Biotin labelled peptides